- Recombinant Aliivibrio salmonicida Probable rRNA maturation factor (VSAL_I0994)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1230383
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 17,700 Da
- E Coli or Yeast
- 1-153
- Probable rRNA maturation factor (VSAL_I0994)
Sequence
MSIELDLQIACENEKDLPSEKDFMSWLNAVLPQFQPQAELTIRIVDEKESHELNHQYRGMDKPTNVLSFPFEAPPEVEIDLLGDLIICRQVVEKEAVEQNKPLLAHWAHMVVHGSLHLLGYDHIEDEEAEEMESLETELMQEMGFEDPYLAEK